PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g085180.1
Common NameMTR_3g085180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 435aa    MW: 47989.1 Da    PI: 8.4675
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g085180.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-41165241278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      CqvegC  dls ak+yhr+h++C+ hsk+pvv+v+gle+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Medtr3g085180.1 165 CQVEGCGLDLSFAKDYHRKHRICDSHSKSPVVVVAGLERRFCQQCSRFHDLSEFDDKKRSCRRRLSDHNARRRKPQP 241
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33158226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.248162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-38163244IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MEWNVKSPGQ WDWENLFFLN SKAAETHRLQ STDWSMEEDR EINVGMLIPS GGSGYSVSKL  60
MHASSSRSSK SASNNSSSNE DSKTSMLTQE GSPDNSTGKK ESSKGDPIET SPAAEPLLTL  120
KLGKRLYFED VSTGSHSKKA SSSAVPLLCG KKGKSSSQNM LNPSCQVEGC GLDLSFAKDY  180
HRKHRICDSH SKSPVVVVAG LERRFCQQCS RFHDLSEFDD KKRSCRRRLS DHNARRRKPQ  240
PEAVKLNPSA LSSSPYDGRQ AMGPFAFPKN TSNLAWPDMP NSKLPQTKDF MLKTPKNFNK  300
IVTMLSDDSS GHFISKGKGT NIAVPGLEDP NTLSDPSATQ DVNRALSLLS TNSWGAYDTK  360
PPSFVHSNRT TGTPQYATAQ RSPFSSPEYW HTDQHQASSS ACISFSGYDN SNRYQDFQLF  420
SEPYESSFPC NQLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271652381184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220237KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1475380.0AC147538.24 Medicago truncatula clone mth2-135c7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601767.20.0squamosa promoter-binding-like protein
TrEMBLG7JBG30.0G7JBG3_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA18G00903.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-53squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Aung B, et al.
    MicroRNA156 as a promising tool for alfalfa improvement.
    Plant Biotechnol. J., 2015. 13(6): p. 779-90
    [PMID:25532560]